(data stored in ACNUC29543 zone)

EMBL: CP000521.PE54

CP000521.PE54        Location/Qualifiers
FT   CDS             61127..62422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0052"
FT                   /product="WecC protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10547"
FT                   /protein_id="ABO10547.2"
FT                   /translation="MQLADLRIAIIGLGYVGLPLAVEFGKKGPVVGFDINQNRIDELKS
FT                   GKDHTLEVSPEELQKAEQLSFSANLDDLKTSNFFIVTVPTPVDQVNRPDLTPLKKASET
FT                   VGQALKKGDIVVYESTVYPGATEEVCIPILEKVSGLKFNQDFFAGYSPERINPGDKVNT
FT                   LTKIKKITSGSTPEVANTVDAVYASIITAGTHKASSIKVAEAAKVIENTQRDLNIALVN
FT                   ELSVIFDRIGIDTLDVLEAAGSKWNFLPFRPGLVGGHCIGVDPYYLTHKAEEVGYHPQV
FT                   ILAGRRINDNMARYVARNTIKLMLQNGIDVPRSKVGVLGVTFKENCPDIRNSKVADLIK
FT                   ELEFWGAQVVVADPWADAEEVKHEYGVELGTVNAQNPVDSLIVAVGHSEFRSLSASELR
FT                   SYVKAEKPVLADVKSLFDRTQMSDVGFTVFRL"
     MQLADLRIAI IGLGYVGLPL AVEFGKKGPV VGFDINQNRI DELKSGKDHT LEVSPEELQK        60
     AEQLSFSANL DDLKTSNFFI VTVPTPVDQV NRPDLTPLKK ASETVGQALK KGDIVVYEST       120
     VYPGATEEVC IPILEKVSGL KFNQDFFAGY SPERINPGDK VNTLTKIKKI TSGSTPEVAN       180
     TVDAVYASII TAGTHKASSI KVAEAAKVIE NTQRDLNIAL VNELSVIFDR IGIDTLDVLE       240
     AAGSKWNFLP FRPGLVGGHC IGVDPYYLTH KAEEVGYHPQ VILAGRRIND NMARYVARNT       300
     IKLMLQNGID VPRSKVGVLG VTFKENCPDI RNSKVADLIK ELEFWGAQVV VADPWADAEE       360
     VKHEYGVELG TVNAQNPVDS LIVAVGHSEF RSLSASELRS YVKAEKPVLA DVKSLFDRTQ       420
     MSDVGFTVFR L                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page