(data stored in ACNUC29543 zone)

EMBL: CP000521.PE540

CP000521.PE540       Location/Qualifiers
FT   CDS             603814..604644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11010"
FT                   /protein_id="ABO11010.2"
FT                   /translation="MHLFDTHTHFDVADFDEDRHQLALEAKKVGVDALVLIGFLQSRFD
FT                   ELVQTHHQLKQWENVPASYLAPGLHPFYIEQHKPEHLSHLEQILQQEDCVAVGEIGLDT
FT                   FLKEHKQPDIYAKQKQYFADQLDLATQYQKPVLLHIRKAHGDVLALLKAHKFKLGGIAH
FT                   AFSGGVEEAKGLIKLGFKIGVTGQITNPNAKKLHTVVQTIGAEHLVIETDCPDMTPLCC
FT                   QTSTEQRTRNTPVNLPYVLKSLAVNLNMAESELADLLWKNSLSALKLIVIKIKD"
     MHLFDTHTHF DVADFDEDRH QLALEAKKVG VDALVLIGFL QSRFDELVQT HHQLKQWENV        60
     PASYLAPGLH PFYIEQHKPE HLSHLEQILQ QEDCVAVGEI GLDTFLKEHK QPDIYAKQKQ       120
     YFADQLDLAT QYQKPVLLHI RKAHGDVLAL LKAHKFKLGG IAHAFSGGVE EAKGLIKLGF       180
     KIGVTGQITN PNAKKLHTVV QTIGAEHLVI ETDCPDMTPL CCQTSTEQRT RNTPVNLPYV       240
     LKSLAVNLNM AESELADLLW KNSLSALKLI VIKIKD                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page