(data stored in ACNUC29543 zone)

EMBL: CP000521.PE544

CP000521.PE544       Location/Qualifiers
FT   CDS             complement(609794..610303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11014"
FT                   /protein_id="ABO11014.2"
FT                   /translation="MIIYDGQVADNYMYQDSNQAAIVVSHSTPSLPYPFTMKPNNHSTE
FT                   TNTPPAIDVEKFVAKLESITSRRSKARCARSIRIALESAGADVENHPIAASDWGDTLKK
FT                   IGYKEINPAFDEPQEGDIYIIHRTRNHIYGHIAGYTGSEWVSDFKQSSYDVYKDDNVTY
FT                   TYYRLG"
     MIIYDGQVAD NYMYQDSNQA AIVVSHSTPS LPYPFTMKPN NHSTETNTPP AIDVEKFVAK        60
     LESITSRRSK ARCARSIRIA LESAGADVEN HPIAASDWGD TLKKIGYKEI NPAFDEPQEG       120
     DIYIIHRTRN HIYGHIAGYT GSEWVSDFKQ SSYDVYKDDN VTYTYYRLG                   169
//

If you have problems or comments...

PBIL Back to PBIL home page