(data stored in ACNUC29543 zone)

EMBL: CP000521.PE549

CP000521.PE549       Location/Qualifiers
FT   CDS             614633..615760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0566"
FT                   /product="pyridine nucleotide transhydrogenase (proton
FT                   pump) alpha subunit (part1)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11019"
FT                   /protein_id="ABO11019.2"
FT                   /translation="MQIGIPTETVVGENRVAATPETVKKLISAGHSVVIERGAGVKAAY
FT                   IDSAYEQVGATITDDAYTGSQIILKVRAPQGGEIQKLAANTTVVAMFDPYRNTELDQFA
FT                   NQQVSAFALELLPRTLSRAQNMDVLSSQANLAGYKSVLLAAAEYQRMFPMLMTAAGTVK
FT                   PARVVIMGVGVAGLQAIATAKRLGAIVEATDLRPTAKDQVESLGGKWLDVPMSEEEQQR
FT                   AADAAKNGYGWMPGEQYIKDQAAIVDKAVSNADIVITTALLPGRDAPRLIKAETVAKMK
FT                   PGSVILDMAVETGGNVEGSKVGETVVTENGVKILGIPNIPATVATEASALYARNVFNFV
FT                   ETLFDKDKNFAINQEDEIQKALLVTHGGQVLLKRG"
     MQIGIPTETV VGENRVAATP ETVKKLISAG HSVVIERGAG VKAAYIDSAY EQVGATITDD        60
     AYTGSQIILK VRAPQGGEIQ KLAANTTVVA MFDPYRNTEL DQFANQQVSA FALELLPRTL       120
     SRAQNMDVLS SQANLAGYKS VLLAAAEYQR MFPMLMTAAG TVKPARVVIM GVGVAGLQAI       180
     ATAKRLGAIV EATDLRPTAK DQVESLGGKW LDVPMSEEEQ QRAADAAKNG YGWMPGEQYI       240
     KDQAAIVDKA VSNADIVITT ALLPGRDAPR LIKAETVAKM KPGSVILDMA VETGGNVEGS       300
     KVGETVVTEN GVKILGIPNI PATVATEASA LYARNVFNFV ETLFDKDKNF AINQEDEIQK       360
     ALLVTHGGQV LLKRG                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page