(data stored in ACNUC29543 zone)

EMBL: CP000521.PE550

CP000521.PE550       Location/Qualifiers
FT   CDS             615772..616086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0567"
FT                   /product="pyridine nucleotide transhydrogenase (proton
FT                   pump) alpha subunit (part2)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11020"
FT                   /protein_id="ABO11020.2"
FT                   /translation="MVETITIFVLAIFVGYYVVWGVTPALHTPLMAVTNALSSIIVVGA
FT                   MLQTVGLPVLGVDANVAFQSVNVVSVLGAIAVFLASINIFGGFAVTARMLEMFKPKQKK
FT                   "
     MVETITIFVL AIFVGYYVVW GVTPALHTPL MAVTNALSSI IVVGAMLQTV GLPVLGVDAN        60
     VAFQSVNVVS VLGAIAVFLA SINIFGGFAV TARMLEMFKP KQKK                        104
//

If you have problems or comments...

PBIL Back to PBIL home page