(data stored in ACNUC29543 zone)

EMBL: CP000521.PE553

CP000521.PE553       Location/Qualifiers
FT   CDS             complement(618678..619079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11023"
FT                   /protein_id="ABO11023.1"
FT                   /translation="MNLEPSPSVSNSHDFAMNTSNKDIQACLKVVHDALVDVKAKDILQ
FT                   LDVSSISNVADAIVIASGTSTRHVKALADNVAEEARKAGFRPIGVEGERDAEWILIDLG
FT                   FVVVHVMLPTARKFYDLESLWRTAPESVA"
     MNLEPSPSVS NSHDFAMNTS NKDIQACLKV VHDALVDVKA KDILQLDVSS ISNVADAIVI        60
     ASGTSTRHVK ALADNVAEEA RKAGFRPIGV EGERDAEWIL IDLGFVVVHV MLPTARKFYD       120
     LESLWRTAPE SVA                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page