(data stored in ACNUC29543 zone)

EMBL: CP000521.PE568

CP000521.PE568       Location/Qualifiers
FT   CDS             635246..636094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0587"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /note="Pantothenate synthetase; Pantoate activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11038"
FT                   /db_xref="GOA:A3M294"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M294"
FT                   /protein_id="ABO11038.2"
FT                   /translation="MKTETTIQGLAASLNPARAARKIIGFVPTMGNLHEGHLTLVREAK
FT                   KLCDVVVVSIFVNPTQFGPGEDFDNYPRTLEQDSRLLADVGCDIIFAPSVEQMYGTQPR
FT                   LTNISVSQITDDLCGSSRPGHFDGVALVVTKLFNIVQPNYAFFGQKDYQQLAVIRQFVQ
FT                   DLNIPLEVIGVPIVRAEDGLALSSRNGYLTPEQRQVAPVIYQGLKQAEEQLHQGKDLQQ
FT                   VLADLKTLLTDNGFVVDYVEARQPNLLAASQFDRDIVLFVAAKLGGTRLIDNLQVAFTP
FT                   Q"
     MKTETTIQGL AASLNPARAA RKIIGFVPTM GNLHEGHLTL VREAKKLCDV VVVSIFVNPT        60
     QFGPGEDFDN YPRTLEQDSR LLADVGCDII FAPSVEQMYG TQPRLTNISV SQITDDLCGS       120
     SRPGHFDGVA LVVTKLFNIV QPNYAFFGQK DYQQLAVIRQ FVQDLNIPLE VIGVPIVRAE       180
     DGLALSSRNG YLTPEQRQVA PVIYQGLKQA EEQLHQGKDL QQVLADLKTL LTDNGFVVDY       240
     VEARQPNLLA ASQFDRDIVL FVAAKLGGTR LIDNLQVAFT PQ                          282
//

If you have problems or comments...

PBIL Back to PBIL home page