(data stored in ACNUC29543 zone)

EMBL: CP000521.PE569

CP000521.PE569       Location/Qualifiers
FT   CDS             636117..636968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11039"
FT                   /db_xref="GOA:A3M295"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M295"
FT                   /protein_id="ABO11039.2"
FT                   /translation="MKRILIVTGQSGSGKSSALQVLEDLGYYCIDNLPLALLPEIVAKL
FT                   DHENNLEQLALGVDVRSTRADMQEFDHVFEQLQKHGTVDVIYLTTQDQDLIARFSASRR
FT                   PHPLANRFKSLLQCIHEEKQLLIPIQFRATVHIDTTDKSVHDLKHILLSKLGQSDNLIV
FT                   ILQSFGYKHGIPLDADYVFDVRHLPNPHWDLELRRFSGLDEPVKQFLEASPQANEMFED
FT                   ILHFLKKWLPAFAEGHRHYMTISIGCTGGQHRSVYMVDRLKQALEAEWSVQVLHREMKH
FT                   WS"
     MKRILIVTGQ SGSGKSSALQ VLEDLGYYCI DNLPLALLPE IVAKLDHENN LEQLALGVDV        60
     RSTRADMQEF DHVFEQLQKH GTVDVIYLTT QDQDLIARFS ASRRPHPLAN RFKSLLQCIH       120
     EEKQLLIPIQ FRATVHIDTT DKSVHDLKHI LLSKLGQSDN LIVILQSFGY KHGIPLDADY       180
     VFDVRHLPNP HWDLELRRFS GLDEPVKQFL EASPQANEMF EDILHFLKKW LPAFAEGHRH       240
     YMTISIGCTG GQHRSVYMVD RLKQALEAEW SVQVLHREMK HWS                         283
//

If you have problems or comments...

PBIL Back to PBIL home page