(data stored in ACNUC29543 zone)

EMBL: CP000521.PE57

CP000521.PE57        Location/Qualifiers
FT   CDS             63980..65059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0055"
FT                   /product="WecE protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10550"
FT                   /protein_id="ABO10550.2"
FT                   /translation="MIDFIDLKAQQNRIKDKIDAGIQNVLTHGQYILGPEVIELEEKLA
FT                   SYVGAKHCITCANGTDALQIAQMAFGIGPDDEVITPGFTYIATAETVALLGAKPVYVDV
FT                   NPKTYNLDSEKLEAAITPRTKAIIPVSLYGQCADFDVINAIAKKYSIPVIEDAAQSFGA
FT                   TYKSRKSCNLSTVACTSFFPSKPLGCYGDGGAIFTNDDELAKVIRQIARHGQDKRYHHI
FT                   RVGVNSRLDTLQAAILLPKLEILDDEMQARQRVAEVYNRLFNEVGIHTTPYIEAHNTSA
FT                   WAQYTIQVDNRAEVQEKLKAQGIPTAVHYPIPLNKQPAVADSDIHLPIGDAIAEKVMSL
FT                   PMHPYLAIDDQLKIVKAFG"
     MIDFIDLKAQ QNRIKDKIDA GIQNVLTHGQ YILGPEVIEL EEKLASYVGA KHCITCANGT        60
     DALQIAQMAF GIGPDDEVIT PGFTYIATAE TVALLGAKPV YVDVNPKTYN LDSEKLEAAI       120
     TPRTKAIIPV SLYGQCADFD VINAIAKKYS IPVIEDAAQS FGATYKSRKS CNLSTVACTS       180
     FFPSKPLGCY GDGGAIFTND DELAKVIRQI ARHGQDKRYH HIRVGVNSRL DTLQAAILLP       240
     KLEILDDEMQ ARQRVAEVYN RLFNEVGIHT TPYIEAHNTS AWAQYTIQVD NRAEVQEKLK       300
     AQGIPTAVHY PIPLNKQPAV ADSDIHLPIG DAIAEKVMSL PMHPYLAIDD QLKIVKAFG        359
//

If you have problems or comments...

PBIL Back to PBIL home page