(data stored in ACNUC29543 zone)

EMBL: CP000521.PE574

CP000521.PE574       Location/Qualifiers
FT   CDS             642014..642352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0593"
FT                   /product="protein chain initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11044"
FT                   /protein_id="ABO11044.2"
FT                   /translation="MDYNKHLFDLKQKQKDAKKKQHQVQVKEIKLRPATDVGDYQVKLR
FT                   AILKFLEEGNKVKITLRFRGREMAHQQLGLAQLQKIEADVAELGVVEQAPKMEGRQMGM
FT                   LLGPKKKK"
     MDYNKHLFDL KQKQKDAKKK QHQVQVKEIK LRPATDVGDY QVKLRAILKF LEEGNKVKIT        60
     LRFRGREMAH QQLGLAQLQK IEADVAELGV VEQAPKMEGR QMGMLLGPKK KK               112
//

If you have problems or comments...

PBIL Back to PBIL home page