(data stored in ACNUC29543 zone)

EMBL: CP000521.PE579

CP000521.PE579       Location/Qualifiers
FT   CDS             645404..645763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0597"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11048"
FT                   /db_xref="GOA:A3M2A4"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2A4"
FT                   /protein_id="ABO11048.1"
FT                   /translation="MARVKRGVVAHRRHKKILARAKGYYGARSRVYRVAFQAVIKAGQY
FT                   AYRDRRQKKRQFRALWIARINAGARQNGLSYSRMIDGLKKAQVIIDRRVLADIAMHDAV
FT                   AFAALAEKAKGALAA"
     MARVKRGVVA HRRHKKILAR AKGYYGARSR VYRVAFQAVI KAGQYAYRDR RQKKRQFRAL        60
     WIARINAGAR QNGLSYSRMI DGLKKAQVII DRRVLADIAM HDAVAFAALA EKAKGALAA        119
//

If you have problems or comments...

PBIL Back to PBIL home page