(data stored in ACNUC29543 zone)

EMBL: CP000521.PE581

CP000521.PE581       Location/Qualifiers
FT   CDS             646090..646407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11049"
FT                   /protein_id="ABO11049.1"
FT                   /translation="MQVKHPNEAKQLGRKVRNYDEQIWREKRFDIVVQANFAKFSQHPE
FT                   LKKFLLATKDRILVEASPVDKIWGVGMAQDHPHIQDPSLWQGLNLLGFALIHVRELLLT
FT                   E"
     MQVKHPNEAK QLGRKVRNYD EQIWREKRFD IVVQANFAKF SQHPELKKFL LATKDRILVE        60
     ASPVDKIWGV GMAQDHPHIQ DPSLWQGLNL LGFALIHVRE LLLTE                       105
//

If you have problems or comments...

PBIL Back to PBIL home page