(data stored in ACNUC29543 zone)

EMBL: CP000521.PE582

CP000521.PE582       Location/Qualifiers
FT   CDS             646466..646969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11050"
FT                   /protein_id="ABO11050.2"
FT                   /translation="MKPLNDTDIRIASFKDALSIAEVHVQSWKETYTGMIKQEILNKLN
FT                   VLDKQQLWKEISRSPDHRLFIYTENGVVKGFLDGYLNPENNIAEIRAFYLLGEIQRKGV
FT                   GRALFQKFYQCALNQGYAFIRLEVFNKNPSRFFYEKMGAKLTGEAELPEFGLGIIELFY
FT                   EWQL"
     MKPLNDTDIR IASFKDALSI AEVHVQSWKE TYTGMIKQEI LNKLNVLDKQ QLWKEISRSP        60
     DHRLFIYTEN GVVKGFLDGY LNPENNIAEI RAFYLLGEIQ RKGVGRALFQ KFYQCALNQG       120
     YAFIRLEVFN KNPSRFFYEK MGAKLTGEAE LPEFGLGIIE LFYEWQL                     167
//

If you have problems or comments...

PBIL Back to PBIL home page