(data stored in ACNUC29543 zone)

EMBL: CP000521.PE587

CP000521.PE587       Location/Qualifiers
FT   CDS             complement(651993..652244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3506"
FT                   /old_locus_tag="AS1_3506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3506"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89931"
FT                   /protein_id="ABS89931.1"
FT                   /translation="MLFKKFAVAAAVAATLAFVGCSKKEEAPAAAAASEAVAAASEATA
FT                   AASEAAVAVDAAASETAAAASEATTAASEATAAASAAH"
     MLFKKFAVAA AVAATLAFVG CSKKEEAPAA AAASEAVAAA SEATAAASEA AVAVDAAASE        60
     TAAAASEATT AASEATAAAS AAH                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page