(data stored in ACNUC29543 zone)

EMBL: CP000521.PE588

CP000521.PE588       Location/Qualifiers
FT   CDS             complement(654250..654576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11055"
FT                   /protein_id="ABO11055.1"
FT                   /translation="MSATIVNTTDDNFQADVLDAETPVLVDFWAGWCAPCKAIAPVLED
FT                   LSSEYAGKVKIVKVDVTSCEETAVKYNIRNIPALLLFKNGEVVAQQIGAVPRSKLVSFI
FT                   DENV"
     MSATIVNTTD DNFQADVLDA ETPVLVDFWA GWCAPCKAIA PVLEDLSSEY AGKVKIVKVD        60
     VTSCEETAVK YNIRNIPALL LFKNGEVVAQ QIGAVPRSKL VSFIDENV                    108
//

If you have problems or comments...

PBIL Back to PBIL home page