(data stored in ACNUC29543 zone)

EMBL: CP000521.PE59

CP000521.PE59        Location/Qualifiers
FT   CDS             66443..67009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0057"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10552"
FT                   /protein_id="ABO10552.2"
FT                   /translation="MKKKLRKLIYFILPCIRLFLNLFFKRKYLEGRFFSKSLSGYVWAV
FT                   RSIWVKNILRLSKPTPFPTALTCSISNPYNIHFHPDDLNNFQSPGTYFQNFSAHIYIGK
FT                   GSYIAPNVGIITSNHDLADLESHTEGKDVVIGDKCWIGMNSVILPGVVLGNGTIVAAGA
FT                   VVTKSFKQGNIVIAGVPAKIIKEIK"
     MKKKLRKLIY FILPCIRLFL NLFFKRKYLE GRFFSKSLSG YVWAVRSIWV KNILRLSKPT        60
     PFPTALTCSI SNPYNIHFHP DDLNNFQSPG TYFQNFSAHI YIGKGSYIAP NVGIITSNHD       120
     LADLESHTEG KDVVIGDKCW IGMNSVILPG VVLGNGTIVA AGAVVTKSFK QGNIVIAGVP       180
     AKIIKEIK                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page