(data stored in ACNUC29543 zone)

EMBL: CP000521.PE590

CP000521.PE590       Location/Qualifiers
FT   CDS             656395..657216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0608"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase (alpha subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11057"
FT                   /db_xref="GOA:A3M2B3"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2B3"
FT                   /protein_id="ABO11057.2"
FT                   /translation="MKKATQSKAWTTVQIARHPERPQFLDYVGEIFTEFDALHGDRLFG
FT                   DDGAMVGGLARFDGQPVMVIGQHRGRSTREKLKHNFGMCNPEGYRKSQRLLDMAERFNL
FT                   PVFTFIDTMGAYPGVGAEERGQAEAIATSLAQLSSLKVPVIATVLGEGGSGGALGIGVA
FT                   DRVIMLSHSIYSVISPEGCASILWKTAEKAAQASEALGLTADKLQSLGIVEYVVDEGEG
FT                   AHLDPERVMQNLKVVLKQALDELLPMDANERCEARYQRLMKFGSENLGMAS"
     MKKATQSKAW TTVQIARHPE RPQFLDYVGE IFTEFDALHG DRLFGDDGAM VGGLARFDGQ        60
     PVMVIGQHRG RSTREKLKHN FGMCNPEGYR KSQRLLDMAE RFNLPVFTFI DTMGAYPGVG       120
     AEERGQAEAI ATSLAQLSSL KVPVIATVLG EGGSGGALGI GVADRVIMLS HSIYSVISPE       180
     GCASILWKTA EKAAQASEAL GLTADKLQSL GIVEYVVDEG EGAHLDPERV MQNLKVVLKQ       240
     ALDELLPMDA NERCEARYQR LMKFGSENLG MAS                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page