(data stored in ACNUC29543 zone)

EMBL: CP000521.PE597

CP000521.PE597       Location/Qualifiers
FT   CDS             complement(666664..667485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11064"
FT                   /protein_id="ABO11064.2"
FT                   /translation="MFENNEYQPHPQNSLKWWGEQHFEINQSKAWQFGSMLFRLTRGIK
FT                   EWRIEYYRPTLQDDNEQDWHIITDANFGFPHSVQVERYMFRKTNPKFLLMPRLADRSVV
FT                   IKPVDPIYIPAGQRGTLYISTPLWIAGLVESQHEPLFEIPVIQPKDTWFGPNAQQGEIC
FT                   YATSVDGRTDLNLLTPRAFRAVTPIDFHNTSNHQLRFDRMNVPVTALPLFYSESTGRLW
FT                   TSQIKVYYEGSDRPARIRIENRTPPLAGEVTYVHPPRSPGGALFNMFDSFF"
     MFENNEYQPH PQNSLKWWGE QHFEINQSKA WQFGSMLFRL TRGIKEWRIE YYRPTLQDDN        60
     EQDWHIITDA NFGFPHSVQV ERYMFRKTNP KFLLMPRLAD RSVVIKPVDP IYIPAGQRGT       120
     LYISTPLWIA GLVESQHEPL FEIPVIQPKD TWFGPNAQQG EICYATSVDG RTDLNLLTPR       180
     AFRAVTPIDF HNTSNHQLRF DRMNVPVTAL PLFYSESTGR LWTSQIKVYY EGSDRPARIR       240
     IENRTPPLAG EVTYVHPPRS PGGALFNMFD SFF                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page