(data stored in ACNUC29543 zone)

EMBL: CP000521.PE598

CP000521.PE598       Location/Qualifiers
FT   CDS             667591..669072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0616"
FT                   /product="secretion protein XcpR"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11065"
FT                   /protein_id="ABO11065.2"
FT                   /translation="MKQIQVPYSFAKRHGVLFRYDGDQVFIVRRQNTEKIALQEARRIL
FT                   GKPAHYQLCTEQEFNSLLSTSYAGDTGESQQVAAGLEDHPDLLSLADQVPETEDLMDQE
FT                   DDAPIVRLINALLSEAIRVGASDIHIEAFEKKLSVRLRVDGQLREIVQPRRELAPLLVS
FT                   RIKVMAKLDIAEKRVPQDGRISLRLAGREVDVRVSTLPSSHGERVVMRLLDKQAGRLNM
FT                   THLGLMANDYERLTQLVHRPHGIILVTGPTGSGKTTTLYAALSDLNDNTRNILTAEDPI
FT                   EYQLEGIGQTQVNTKVDMTFARALKAMLRQDPDVVMVGEIRDLETAEIAVQASLTGHLV
FT                   LSTLHTNTAIGAVTRLKDMGIEPFLLSSSLIGVVAQRLVRTLCPHCMTWREADTFEKQV
FT                   FQHISHEPSLKLPEAQGCDQCSHLGFNGRTAIYEIVPIDEPMRRLIHGNAAEFELENHA
FT                   RQYSGSIRDDGLRKVLSGKTTLEEVLRVTNEASEA"
     MKQIQVPYSF AKRHGVLFRY DGDQVFIVRR QNTEKIALQE ARRILGKPAH YQLCTEQEFN        60
     SLLSTSYAGD TGESQQVAAG LEDHPDLLSL ADQVPETEDL MDQEDDAPIV RLINALLSEA       120
     IRVGASDIHI EAFEKKLSVR LRVDGQLREI VQPRRELAPL LVSRIKVMAK LDIAEKRVPQ       180
     DGRISLRLAG REVDVRVSTL PSSHGERVVM RLLDKQAGRL NMTHLGLMAN DYERLTQLVH       240
     RPHGIILVTG PTGSGKTTTL YAALSDLNDN TRNILTAEDP IEYQLEGIGQ TQVNTKVDMT       300
     FARALKAMLR QDPDVVMVGE IRDLETAEIA VQASLTGHLV LSTLHTNTAI GAVTRLKDMG       360
     IEPFLLSSSL IGVVAQRLVR TLCPHCMTWR EADTFEKQVF QHISHEPSLK LPEAQGCDQC       420
     SHLGFNGRTA IYEIVPIDEP MRRLIHGNAA EFELENHARQ YSGSIRDDGL RKVLSGKTTL       480
     EEVLRVTNEA SEA                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page