(data stored in ACNUC29543 zone)

EMBL: CP000521.PE599

CP000521.PE599       Location/Qualifiers
FT   CDS             complement(669127..669558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11066"
FT                   /protein_id="ABO11066.2"
FT                   /translation="MSLEKVVYRAKAKATGGRDGRATSSDGVLDVQLGVPKEMGGAGGA
FT                   VTNPEQLFAAGYSACFLGALKFVANRDKFNISKDAYVEGEVGIGPIPTGFSIEVTLNVY
FT                   LIGMDREEAEKLVAAAHIVCPYSNATRNNIDVTFNIVTE"
     MSLEKVVYRA KAKATGGRDG RATSSDGVLD VQLGVPKEMG GAGGAVTNPE QLFAAGYSAC        60
     FLGALKFVAN RDKFNISKDA YVEGEVGIGP IPTGFSIEVT LNVYLIGMDR EEAEKLVAAA       120
     HIVCPYSNAT RNNIDVTFNI VTE                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page