(data stored in ACNUC29543 zone)

EMBL: CP000521.PE609

CP000521.PE609       Location/Qualifiers
FT   CDS             679422..680321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11075"
FT                   /protein_id="ABO11075.2"
FT                   /translation="MIDTLLSPFSVKHELYSKLKKHQENRINIVDKDSIYLFDIFSFES
FT                   FKIKSKSPYSHLAYFSCSYTDDVTELELCFNPIFQDYDIPKLTIDISQLCGFGHSKSDL
FT                   FKYKSIDEFVENECPSYIETISQTQLRLMLSHNGIQIVNSPDSTFDNFYMYGWQPKVFL
FT                   SNEDGSHHLASAQYIALRLNQPVPLTARLIYKVIRGEQLANFHDRICKRYITPLHELDD
FT                   YFKWFDNSNIKFIRLDDSLHEYAVYFFKRTSENERIIELFSSKFSSLNQILWKRLSDQT
FT                   NNMLLKALVPLNSGCWSY"
     MIDTLLSPFS VKHELYSKLK KHQENRINIV DKDSIYLFDI FSFESFKIKS KSPYSHLAYF        60
     SCSYTDDVTE LELCFNPIFQ DYDIPKLTID ISQLCGFGHS KSDLFKYKSI DEFVENECPS       120
     YIETISQTQL RLMLSHNGIQ IVNSPDSTFD NFYMYGWQPK VFLSNEDGSH HLASAQYIAL       180
     RLNQPVPLTA RLIYKVIRGE QLANFHDRIC KRYITPLHEL DDYFKWFDNS NIKFIRLDDS       240
     LHEYAVYFFK RTSENERIIE LFSSKFSSLN QILWKRLSDQ TNNMLLKALV PLNSGCWSY        299
//

If you have problems or comments...

PBIL Back to PBIL home page