(data stored in ACNUC29543 zone)

EMBL: CP000521.PE613

CP000521.PE613       Location/Qualifiers
FT   CDS             682619..683410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3511"
FT                   /old_locus_tag="AS1_3511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3511"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89936"
FT                   /protein_id="ABS89936.2"
FT                   /translation="MSNEKKFFLNSFKRNAKLLNTSFDVVSNTLNTPFKAPTYTQCLEI
FT                   SARALGFKTFKGLTLSDLTEVNEIRYLSDFDKTKLIESYLDVNRKKITTMPLKIDSSLD
FT                   LNSTIDAVCTLAYHIQTFPLLRDFYLPKRYLSKHLDFDKGPFTINDTLSKICAHWCISL
FT                   LIEKPKGYEFYKGVYENNNDILYDVPMSFFTKKKINDWYKSRDFLHDFTDLFQHCDFIR
FT                   VQSGWTDFDNMSNSKINIFIPPALHERITELVNPLKGGPAN"
     MSNEKKFFLN SFKRNAKLLN TSFDVVSNTL NTPFKAPTYT QCLEISARAL GFKTFKGLTL        60
     SDLTEVNEIR YLSDFDKTKL IESYLDVNRK KITTMPLKID SSLDLNSTID AVCTLAYHIQ       120
     TFPLLRDFYL PKRYLSKHLD FDKGPFTIND TLSKICAHWC ISLLIEKPKG YEFYKGVYEN       180
     NNDILYDVPM SFFTKKKIND WYKSRDFLHD FTDLFQHCDF IRVQSGWTDF DNMSNSKINI       240
     FIPPALHERI TELVNPLKGG PAN                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page