(data stored in ACNUC29543 zone)

EMBL: CP000521.PE621

CP000521.PE621       Location/Qualifiers
FT   CDS             complement(690099..690749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3517"
FT                   /old_locus_tag="AS1_3517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3517"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89942"
FT                   /protein_id="ABS89942.2"
FT                   /translation="MTNLASMPYAHSLYLNEPAEWKKQSSVQLSLLDDVQEPSVVERSL
FT                   PALPLKRFSKLFSFLDFDFDTKSYEYMVGSDRFTIETKIDKADQAFVCLINEVLMAYKQ
FT                   KNILLTSFDSKLTHTINASEISKVVGISLDEFEKRMKSLASCSLSAHQHRLLRHTKTGR
FT                   ESFRFVICFQPNSLVNTFLLIKMGRFSTALIMHLSLKRCLKKTYIRKINHNLI"
     MTNLASMPYA HSLYLNEPAE WKKQSSVQLS LLDDVQEPSV VERSLPALPL KRFSKLFSFL        60
     DFDFDTKSYE YMVGSDRFTI ETKIDKADQA FVCLINEVLM AYKQKNILLT SFDSKLTHTI       120
     NASEISKVVG ISLDEFEKRM KSLASCSLSA HQHRLLRHTK TGRESFRFVI CFQPNSLVNT       180
     FLLIKMGRFS TALIMHLSLK RCLKKTYIRK INHNLI                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page