(data stored in ACNUC29543 zone)

EMBL: CP000521.PE622

CP000521.PE622       Location/Qualifiers
FT   CDS             691527..692903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3518"
FT                   /old_locus_tag="AS1_3518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3518"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89943"
FT                   /protein_id="ABS89943.2"
FT                   /translation="MIKNNDLDNLRNLNRNIIQNKPNSAPATPQRLFVYLDGIAQNNDG
FT                   HDYAYGTNVLTNEKVKVRLTTIDERIDDLVDSGRAKNRQQVASQVTNQYQNSANPRQSL
FT                   KARLNSNVVVLSFDQSFEIKSEDNYRSYRSHWAESVTSNPSSQLITAPVHIQFVNNQRP
FT                   FGRVEILEENFKIDIGSSKENIKDAFLKSLVHQDEFSAERSGSLNYILRYKDTNEPIYQ
FT                   GSLQTFLQQVSVGPDRSIRIPADINTTLNNLMRKPLTTQDFTPDDSMMFNHDLNRILVN
FT                   RFLGVEFSQKLETSNPQLQDNLRLISGKLKKGEIYLDAYSTQNIFFGRDTLKTYQAKAN
FT                   RNSSPLKIYTVTDMHNEQPVYQKGYIHSLVGIDRHSDTLAPFVTFSSTTDPMAVSKKIQ
FT                   DLNINEENLKRTIYLKEEFQKHPLPNSAAPVVDKERANINRIREEMQNQSNNSINFNNI
FT                   "
     MIKNNDLDNL RNLNRNIIQN KPNSAPATPQ RLFVYLDGIA QNNDGHDYAY GTNVLTNEKV        60
     KVRLTTIDER IDDLVDSGRA KNRQQVASQV TNQYQNSANP RQSLKARLNS NVVVLSFDQS       120
     FEIKSEDNYR SYRSHWAESV TSNPSSQLIT APVHIQFVNN QRPFGRVEIL EENFKIDIGS       180
     SKENIKDAFL KSLVHQDEFS AERSGSLNYI LRYKDTNEPI YQGSLQTFLQ QVSVGPDRSI       240
     RIPADINTTL NNLMRKPLTT QDFTPDDSMM FNHDLNRILV NRFLGVEFSQ KLETSNPQLQ       300
     DNLRLISGKL KKGEIYLDAY STQNIFFGRD TLKTYQAKAN RNSSPLKIYT VTDMHNEQPV       360
     YQKGYIHSLV GIDRHSDTLA PFVTFSSTTD PMAVSKKIQD LNINEENLKR TIYLKEEFQK       420
     HPLPNSAAPV VDKERANINR IREEMQNQSN NSINFNNI                               458
//

If you have problems or comments...

PBIL Back to PBIL home page