(data stored in ACNUC29543 zone)

EMBL: CP000521.PE624

CP000521.PE624       Location/Qualifiers
FT   CDS             697363..698877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3519"
FT                   /old_locus_tag="AS1_3519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3519"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89944"
FT                   /protein_id="ABS89944.2"
FT                   /translation="MSHVSDSAFFEPAYFQKVSYKSETKPFHGDDVISLIDKSRQLTRQ
FT                   QLFKHLCNFDDNFASTMEGKDQELSLSSLIKFYNDAQKQILERELRESIKYSASQSFFK
FT                   SKIDKYEFTEIENFILNKPNLDEIKEFLKISAENNNFLHIYQGLNKALTVVEFVEKLQI
FT                   LEEHQSFNINFAISMKESLWDQHYHRETNENALIRVMFPKLGASSLLASNYEIRYVYPS
FT                   SDFVHSSKLKYLIEDAALTPTLLRNVGTHLFIDGNKKEEEFSFMKTLNEIEYLKTNSPL
FT                   LLSFDKYEPTAIERTATLLTGNIINALNAASVAKLSSQMINYTDASGNRQRAVMLYDDC
FT                   ELEEVLDKVKGLSTIQEAITYFERVHDAIEMNEKPTLPDFYIVRSNSNGNPTIELNLKP
FT                   LNEETYNFVITGSRKHIKQVAEMDSIFVQAGSGNRSDSLNLVLKGDLSQGTRSSQTVQV
FT                   PIEKVTKLLTNLSTEFSTVKINNLDPDVLDQLKPNTSNKLTQNLMY"
     MSHVSDSAFF EPAYFQKVSY KSETKPFHGD DVISLIDKSR QLTRQQLFKH LCNFDDNFAS        60
     TMEGKDQELS LSSLIKFYND AQKQILEREL RESIKYSASQ SFFKSKIDKY EFTEIENFIL       120
     NKPNLDEIKE FLKISAENNN FLHIYQGLNK ALTVVEFVEK LQILEEHQSF NINFAISMKE       180
     SLWDQHYHRE TNENALIRVM FPKLGASSLL ASNYEIRYVY PSSDFVHSSK LKYLIEDAAL       240
     TPTLLRNVGT HLFIDGNKKE EEFSFMKTLN EIEYLKTNSP LLLSFDKYEP TAIERTATLL       300
     TGNIINALNA ASVAKLSSQM INYTDASGNR QRAVMLYDDC ELEEVLDKVK GLSTIQEAIT       360
     YFERVHDAIE MNEKPTLPDF YIVRSNSNGN PTIELNLKPL NEETYNFVIT GSRKHIKQVA       420
     EMDSIFVQAG SGNRSDSLNL VLKGDLSQGT RSSQTVQVPI EKVTKLLTNL STEFSTVKIN       480
     NLDPDVLDQL KPNTSNKLTQ NLMY                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page