(data stored in ACNUC29543 zone)

EMBL: CP000521.PE625

CP000521.PE625       Location/Qualifiers
FT   CDS             698891..700942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3520"
FT                   /old_locus_tag="AS1_3520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3520"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89945"
FT                   /protein_id="ABS89945.2"
FT                   /translation="MDNKEEMKAAPQALNEIDWKDEIVFDELLSKVGPITPPDTTLKSS
FT                   DLEAYGYQSQVMLPVSEARAKELYEKIELYRLYEDGTEALVEDLADLNSHAQKDGLFGV
FT                   QENDWRNYQLKIEKSNDSENSNDLENFQYFSYPALAQSIIKREGDQFFANYELSRSLGS
FT                   DEDITILNKEFYKEHKADLDILLNELTISEQYEHQGYAVLYATKSNLSALNSDEEIEAE
FT                   ANEIKLFLEGNNDDPKYAYVYDTLYELSAENVFNEFKALETRIERDMDLEEGNFDLPFQ
FT                   HAVEETMETFDNNAPISNLPFDSLKEPEGFMEDIEQYSYAEDQNFGSSLPINNEEMIQK
FT                   SEVKEEKEKIDVNDVGVPEQLIINGKEFNFEQIDPNDIEKHEQLRAALSQLLGNTNAST
FT                   FQSPSQINPVTSTPLIPPSMPDFNENSAQPSTVKNYSLFPSFANLKKATPDNALSLLQA
FT                   EQLLQTSQNIQAPASENSGAHMNTQNVQHMLSSHLASSKYNDLVNSHKNYSDSINEFWK
FT                   FDKFEDFRGTLIERGQKENKDLKTLINEMNTDPNSPYRKEFQDLIVNVGSTEKGKALLS
FT                   KLNNSHQDFLSRSDSMFEVIQKSELSPDDKTKFENKLSEVVENQAELSSTLPNYINDDG
FT                   VRISLADEMKKYAESLKKALQVVVDFVKSKVGLSVDGPTEQPSSSPSP"
     MDNKEEMKAA PQALNEIDWK DEIVFDELLS KVGPITPPDT TLKSSDLEAY GYQSQVMLPV        60
     SEARAKELYE KIELYRLYED GTEALVEDLA DLNSHAQKDG LFGVQENDWR NYQLKIEKSN       120
     DSENSNDLEN FQYFSYPALA QSIIKREGDQ FFANYELSRS LGSDEDITIL NKEFYKEHKA       180
     DLDILLNELT ISEQYEHQGY AVLYATKSNL SALNSDEEIE AEANEIKLFL EGNNDDPKYA       240
     YVYDTLYELS AENVFNEFKA LETRIERDMD LEEGNFDLPF QHAVEETMET FDNNAPISNL       300
     PFDSLKEPEG FMEDIEQYSY AEDQNFGSSL PINNEEMIQK SEVKEEKEKI DVNDVGVPEQ       360
     LIINGKEFNF EQIDPNDIEK HEQLRAALSQ LLGNTNASTF QSPSQINPVT STPLIPPSMP       420
     DFNENSAQPS TVKNYSLFPS FANLKKATPD NALSLLQAEQ LLQTSQNIQA PASENSGAHM       480
     NTQNVQHMLS SHLASSKYND LVNSHKNYSD SINEFWKFDK FEDFRGTLIE RGQKENKDLK       540
     TLINEMNTDP NSPYRKEFQD LIVNVGSTEK GKALLSKLNN SHQDFLSRSD SMFEVIQKSE       600
     LSPDDKTKFE NKLSEVVENQ AELSSTLPNY INDDGVRISL ADEMKKYAES LKKALQVVVD       660
     FVKSKVGLSV DGPTEQPSSS PSP                                               683
//

If you have problems or comments...

PBIL Back to PBIL home page