(data stored in ACNUC29543 zone)

EMBL: CP000521.PE626

CP000521.PE626       Location/Qualifiers
FT   CDS             701359..702009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3521"
FT                   /old_locus_tag="AS1_3521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3521"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89946"
FT                   /protein_id="ABS89946.2"
FT                   /translation="MNIVEKHSKIKPTDNANTPAGIWDNKMESLVERSAKQDLDTFLRF
FT                   ICTYALNDTYVSKDLITESLKDLPQSVVTFVYLLEFSPNDQISSITSISDSVLKTLSEL
FT                   IHNFRNERINSNGYSIIFDFFSANPFSYFIYFLRNVITANIDELPLVVNLNITDFFQFL
FT                   LDRKSSVFHSRIFYFIRAWQTVSVYNEANISELKETMLYASQNKVFPNISVSS"
     MNIVEKHSKI KPTDNANTPA GIWDNKMESL VERSAKQDLD TFLRFICTYA LNDTYVSKDL        60
     ITESLKDLPQ SVVTFVYLLE FSPNDQISSI TSISDSVLKT LSELIHNFRN ERINSNGYSI       120
     IFDFFSANPF SYFIYFLRNV ITANIDELPL VVNLNITDFF QFLLDRKSSV FHSRIFYFIR       180
     AWQTVSVYNE ANISELKETM LYASQNKVFP NISVSS                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page