(data stored in ACNUC29543 zone)

EMBL: CP000521.PE63

CP000521.PE63        Location/Qualifiers
FT   CDS             69615..70655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3483"
FT                   /old_locus_tag="AS1_3483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3483"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89908"
FT                   /protein_id="ABS89908.2"
FT                   /translation="MSLKIRKELLIFLILSSFLSLLVGFRGNTNDTITYYMIFKNIGSY
FT                   DLTNFSLFYNETGVEIGWGLYSKIISLFSDSPVVLFTIFSFFTFFTFYRISRLVEIKFL
FT                   YVMLYYLPTGFFMMQQFMQIRQGFAIPLVIYGSVLYLSGKKYISLVFFILAILFHQSSL
FT                   AFILIFISYLFFNNFLKINTSVFKFFIINILILVFGFIVARFILLDAAMDYFQRLEAYS
FT                   TTDYAESVGFFSLSNIKFYIEFFLIFLLLNNRLLLNKFIVFFVFIFTVGLSLRVAFYDF
FT                   GILSGRLSNTFLLIEVFLMPMLLSSRLNKIYLYIYFLLYFLVIFYVTWTFQASEFIKNN
FT                   YFLPLS"
     MSLKIRKELL IFLILSSFLS LLVGFRGNTN DTITYYMIFK NIGSYDLTNF SLFYNETGVE        60
     IGWGLYSKII SLFSDSPVVL FTIFSFFTFF TFYRISRLVE IKFLYVMLYY LPTGFFMMQQ       120
     FMQIRQGFAI PLVIYGSVLY LSGKKYISLV FFILAILFHQ SSLAFILIFI SYLFFNNFLK       180
     INTSVFKFFI INILILVFGF IVARFILLDA AMDYFQRLEA YSTTDYAESV GFFSLSNIKF       240
     YIEFFLIFLL LNNRLLLNKF IVFFVFIFTV GLSLRVAFYD FGILSGRLSN TFLLIEVFLM       300
     PMLLSSRLNK IYLYIYFLLY FLVIFYVTWT FQASEFIKNN YFLPLS                      346
//

If you have problems or comments...

PBIL Back to PBIL home page