(data stored in ACNUC29543 zone)

EMBL: CP000521.PE630

CP000521.PE630       Location/Qualifiers
FT   CDS             704973..706106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11080"
FT                   /protein_id="ABO11080.2"
FT                   /translation="MKKKTTFLLLSVFSTSVIAAYCPPFSNPLILRDFISGFQQLNATF
FT                   TTGLNTLDQSVSAALTTERQLLLNAIALKTTQEAMNASSIAHADQEIAKATANAIGAVK
FT                   QSERLKETAIDFGAAGQGYNPCKVLNERRTITETQERDKENRPDLIFKEISAGTGKYAN
FT                   PVVAQEQTLKLHHDYFCTSEQVSAGLCMSVGEMSGANLQASTLFEYSSANDKYAIAKTS
FT                   FINNMVGLPDAPLSANAAKTPRGKEYMRQKVENDAVISPAINSLMAIKSEFTENPNGGE
FT                   FGQPVKPLRQQYREQVDRYLGHGEEYKNWNRTLVAAPERGVLVEILKEGALELAIMGNK
FT                   HAQNERIEANLASLVALENKKANSLNKSNIAGSAKAK"
     MKKKTTFLLL SVFSTSVIAA YCPPFSNPLI LRDFISGFQQ LNATFTTGLN TLDQSVSAAL        60
     TTERQLLLNA IALKTTQEAM NASSIAHADQ EIAKATANAI GAVKQSERLK ETAIDFGAAG       120
     QGYNPCKVLN ERRTITETQE RDKENRPDLI FKEISAGTGK YANPVVAQEQ TLKLHHDYFC       180
     TSEQVSAGLC MSVGEMSGAN LQASTLFEYS SANDKYAIAK TSFINNMVGL PDAPLSANAA       240
     KTPRGKEYMR QKVENDAVIS PAINSLMAIK SEFTENPNGG EFGQPVKPLR QQYREQVDRY       300
     LGHGEEYKNW NRTLVAAPER GVLVEILKEG ALELAIMGNK HAQNERIEAN LASLVALENK       360
     KANSLNKSNI AGSAKAK                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page