(data stored in ACNUC29543 zone)

EMBL: CP000521.PE632

CP000521.PE632       Location/Qualifiers
FT   CDS             710418..711071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3524"
FT                   /old_locus_tag="AS1_3524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3524"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89949"
FT                   /protein_id="ABS89949.2"
FT                   /translation="MNASQTIQTVQFGLDQYSKLVKDLKVLSGIDAFYTAKCLIESFPN
FT                   VVNDEFYGYDFYADEKILDISSYIHIDENKWFNLNCLIDLEEKIVSINLASEMENGEIF
FT                   LFRTDKNYQVAVNYNYSFENFFSLQSNFEYSLFDLVLSSMGLSLLPKKIFNNFELKDIF
FT                   LFSMSIVTGRYKNYIPDQLFFNSIHKNIVLDLKSDELELPSRLINYRDEIDLKW"
     MNASQTIQTV QFGLDQYSKL VKDLKVLSGI DAFYTAKCLI ESFPNVVNDE FYGYDFYADE        60
     KILDISSYIH IDENKWFNLN CLIDLEEKIV SINLASEMEN GEIFLFRTDK NYQVAVNYNY       120
     SFENFFSLQS NFEYSLFDLV LSSMGLSLLP KKIFNNFELK DIFLFSMSIV TGRYKNYIPD       180
     QLFFNSIHKN IVLDLKSDEL ELPSRLINYR DEIDLKW                                217
//

If you have problems or comments...

PBIL Back to PBIL home page