(data stored in ACNUC29543 zone)

EMBL: CP000521.PE633

CP000521.PE633       Location/Qualifiers
FT   CDS             712236..713729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3525"
FT                   /old_locus_tag="AS1_3525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3525"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89950"
FT                   /protein_id="ABS89950.2"
FT                   /translation="MRIFKYELEDALQSLDNSVSYAGFINKLFPKFISKDVDNINTITI
FT                   NIILKKIQDLLSSGYYSVFINYKNYMTNGERVWGLHHFCMCIYLHENFEPFGTYSWDAS
FT                   SHPQMILDFWSLTSSNRYELHEVGLTYNQVNNSDHTERMNIDIEMAWEELVILNPTFNF
FT                   PFFRNFFYLSCLSIFNISDYQKFGKLLSLNYSIDHLLDQLRHNLFNFLDLLDDYMLNID
FT                   LSESTYSFADGTSFTMFAEVSEQDLLNYDFSFVSDSSSSEDSTAQQSQTFSTSDQHSVP
FT                   SRVDNSYLSFLSKQDIHEEITSNYVRELIKQFFYNYSKVSFSIHNTSIPCGFVADFLDY
FT                   LNRSLEQIFIKVESLKVNYLKLQFIYQTSHTLSSMYFYKYIVDNYTSIFINISVPESLK
FT                   KEVLVKVRSLSIFIKNKINKLNDVLVHDPLFINVYSLIFFYLDSFSQSLNYIRCSGGEL
FT                   DKDRLDLIYNNELEYIDALDFNFFQYLARRLPRQVYRLP"
     MRIFKYELED ALQSLDNSVS YAGFINKLFP KFISKDVDNI NTITINIILK KIQDLLSSGY        60
     YSVFINYKNY MTNGERVWGL HHFCMCIYLH ENFEPFGTYS WDASSHPQMI LDFWSLTSSN       120
     RYELHEVGLT YNQVNNSDHT ERMNIDIEMA WEELVILNPT FNFPFFRNFF YLSCLSIFNI       180
     SDYQKFGKLL SLNYSIDHLL DQLRHNLFNF LDLLDDYMLN IDLSESTYSF ADGTSFTMFA       240
     EVSEQDLLNY DFSFVSDSSS SEDSTAQQSQ TFSTSDQHSV PSRVDNSYLS FLSKQDIHEE       300
     ITSNYVRELI KQFFYNYSKV SFSIHNTSIP CGFVADFLDY LNRSLEQIFI KVESLKVNYL       360
     KLQFIYQTSH TLSSMYFYKY IVDNYTSIFI NISVPESLKK EVLVKVRSLS IFIKNKINKL       420
     NDVLVHDPLF INVYSLIFFY LDSFSQSLNY IRCSGGELDK DRLDLIYNNE LEYIDALDFN       480
     FFQYLARRLP RQVYRLP                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page