(data stored in ACNUC29543 zone)

EMBL: CP000521.PE635

CP000521.PE635       Location/Qualifiers
FT   CDS             complement(714272..714841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3527"
FT                   /old_locus_tag="AS1_3527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3527"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89952"
FT                   /protein_id="ABS89952.2"
FT                   /translation="MYSSTKSFSNLYASIVHMQEHQSLEELQANQIINHAMKNGPDHKL
FT                   NRLLEDQILNGVKGFNIENMGMKHEIFNDKVLMNLKRERATLQDINSIIIDTALQFSRN
FT                   PDQIELNEEKLKSSLNTIKNLHCERSLKIDLIRNMKEGVLTFVPEEQRNDIERVIISKQ
FT                   REIERTATQSNKVVLESKIPNSFNPR"
     MYSSTKSFSN LYASIVHMQE HQSLEELQAN QIINHAMKNG PDHKLNRLLE DQILNGVKGF        60
     NIENMGMKHE IFNDKVLMNL KRERATLQDI NSIIIDTALQ FSRNPDQIEL NEEKLKSSLN       120
     TIKNLHCERS LKIDLIRNMK EGVLTFVPEE QRNDIERVII SKQREIERTA TQSNKVVLES       180
     KIPNSFNPR                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page