(data stored in ACNUC29543 zone)

EMBL: CP000521.PE644

CP000521.PE644       Location/Qualifiers
FT   CDS             complement(727285..728169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0639"
FT                   /product="IncC protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11088"
FT                   /protein_id="ABO11088.2"
FT                   /translation="MNDKTSQIKDAGILTIGNGKGGIGKSTFTVHSAYFFSQHGYKVIV
FT                   VDLDNQGNSSGHLLKLNSNTVLPEYVTRPSTPVHNLGDAVSLFHKDNQNLKCDLQNGSI
FT                   GVFRPTKALASINTSSDKELVAIFQENINKLLKYKTVIIFDTPPTLSNLMLLPLSVSNV
FT                   VIIPTMLSQYALDGIRDYISFTNNIKKALNTKLLLGGIVPNRVNMKSSIQKEELAKLLA
FT                   EGESNSIFYKDKNNIAYITDKNVIEEAVNYGCACWHINKTSSRDVKRTFFNIFKQVGVQ
FT                   LKLAAFNSSSKGE"
     MNDKTSQIKD AGILTIGNGK GGIGKSTFTV HSAYFFSQHG YKVIVVDLDN QGNSSGHLLK        60
     LNSNTVLPEY VTRPSTPVHN LGDAVSLFHK DNQNLKCDLQ NGSIGVFRPT KALASINTSS       120
     DKELVAIFQE NINKLLKYKT VIIFDTPPTL SNLMLLPLSV SNVVIIPTML SQYALDGIRD       180
     YISFTNNIKK ALNTKLLLGG IVPNRVNMKS SIQKEELAKL LAEGESNSIF YKDKNNIAYI       240
     TDKNVIEEAV NYGCACWHIN KTSSRDVKRT FFNIFKQVGV QLKLAAFNSS SKGE             294
//

If you have problems or comments...

PBIL Back to PBIL home page