(data stored in ACNUC29543 zone)

EMBL: CP000521.PE646

CP000521.PE646       Location/Qualifiers
FT   CDS             complement(729256..729573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3531"
FT                   /old_locus_tag="AS1_3531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3531"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89956"
FT                   /protein_id="ABS89956.2"
FT                   /translation="MAKKLPPHIVDALEALEENEIESASLNALRLRAWLYFIRFLSSFQ
FT                   TNYETKNPYSSIQFTHHQASLFAFGIDDKNPENFLLFAQENDFWWLSEIGIEYFTFIEN
FT                   S"
     MAKKLPPHIV DALEALEENE IESASLNALR LRAWLYFIRF LSSFQTNYET KNPYSSIQFT        60
     HHQASLFAFG IDDKNPENFL LFAQENDFWW LSEIGIEYFT FIENS                       105
//

If you have problems or comments...

PBIL Back to PBIL home page