(data stored in ACNUC29543 zone)

EMBL: CP000521.PE649

CP000521.PE649       Location/Qualifiers
FT   CDS             complement(731423..732367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11089"
FT                   /protein_id="ABO11089.2"
FT                   /translation="MKTKSLGNSNKKSSFKFPHVALAALLGFGAAGGWFYYESHNVPTG
FT                   VTSNSTNLYSENLFAQMSKLGQVSNVQPMAGELLAWTMLINGQPQVVFTTKDEKVVITG
FT                   NAFDTATMDSVSLPILQKAQQGGAPANSTGVAAPTGGNVAVDFAEIVGKWDKEVPPSIS
FT                   LLDKLKGAKEGNASAVDTLYIVFDPRCSNCHDAYRATRKYVEKGFSIKWIPTTLLGKHE
FT                   EGAKLAAAVLRDPKQLERAFSKDPNIVVNPTPEEKKALEENVQFLTEATVQSTGSQTIA
FT                   VPTAFYLNKKTGEPKMTTGLSDESILEMIFGKI"
     MKTKSLGNSN KKSSFKFPHV ALAALLGFGA AGGWFYYESH NVPTGVTSNS TNLYSENLFA        60
     QMSKLGQVSN VQPMAGELLA WTMLINGQPQ VVFTTKDEKV VITGNAFDTA TMDSVSLPIL       120
     QKAQQGGAPA NSTGVAAPTG GNVAVDFAEI VGKWDKEVPP SISLLDKLKG AKEGNASAVD       180
     TLYIVFDPRC SNCHDAYRAT RKYVEKGFSI KWIPTTLLGK HEEGAKLAAA VLRDPKQLER       240
     AFSKDPNIVV NPTPEEKKAL EENVQFLTEA TVQSTGSQTI AVPTAFYLNK KTGEPKMTTG       300
     LSDESILEMI FGKI                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page