(data stored in ACNUC29543 zone)

EMBL: CP000521.PE652

CP000521.PE652       Location/Qualifiers
FT   CDS             complement(734600..735658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11091"
FT                   /protein_id="ABO11091.2"
FT                   /translation="MKGYKTLTVGVDDGHDGIKIYCGEVGKSFRLPSRVANGRTIIGDT
FT                   DEVNKQIIHVNGKYFTVDEFTKEHIDTRTEDYPLSDANVALVHHALHQAFDGQYRKFKI
FT                   ATGLPLNRYYGGKDKAKNEKLIADKTQNLLINKDFNNPTVYNLYEHDKKNDPLQILNHI
FT                   VLSEGQCAYFDALMDDNGKRSSMYEDLWEGGCAIIDIGGRTTDIAMINPRGGTMQASRC
FT                   DTLDVGIITLKNKVSQNLKEFFGLSSNITDWRLSKALKTGIYNHGGKDHDISKILNAAK
FT                   VEITDQIENSIKVNVQDGQDLGAVLLVGGGSITLGDELLKRFNYDNWHLVKQPEFANAR
FT                   GMYKCAKYISKL"
     MKGYKTLTVG VDDGHDGIKI YCGEVGKSFR LPSRVANGRT IIGDTDEVNK QIIHVNGKYF        60
     TVDEFTKEHI DTRTEDYPLS DANVALVHHA LHQAFDGQYR KFKIATGLPL NRYYGGKDKA       120
     KNEKLIADKT QNLLINKDFN NPTVYNLYEH DKKNDPLQIL NHIVLSEGQC AYFDALMDDN       180
     GKRSSMYEDL WEGGCAIIDI GGRTTDIAMI NPRGGTMQAS RCDTLDVGII TLKNKVSQNL       240
     KEFFGLSSNI TDWRLSKALK TGIYNHGGKD HDISKILNAA KVEITDQIEN SIKVNVQDGQ       300
     DLGAVLLVGG GSITLGDELL KRFNYDNWHL VKQPEFANAR GMYKCAKYIS KL               352
//

If you have problems or comments...

PBIL Back to PBIL home page