(data stored in ACNUC29543 zone)

EMBL: CP000521.PE654

CP000521.PE654       Location/Qualifiers
FT   CDS             complement(737245..738063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11093"
FT                   /protein_id="ABO11093.2"
FT                   /translation="MADLPNYQYYLQQSPIIISQDDSAKQAESSARLESIKTLVHEAAT
FT                   RNALRARLTEIDKVVYNPNNVRKLDSIYDFQRLMINTVVVPPVIVQANNISDVQNPRTL
FT                   SVLGVRYEIKENARFSHTPPNWRDFLQFNVKSYEIGVDALPNELKPKNSAEERAFKEAM
FT                   NKGIEDGVREADAIFKHQLNRLNQTYKGMIAFHRFVMDGKITMPAIARRDIALTGNGNT
FT                   LMLNQTNFEITSLPQFVNNTKLWNSRILSIKERSVVKDPVETPVAIETQQ"
     MADLPNYQYY LQQSPIIISQ DDSAKQAESS ARLESIKTLV HEAATRNALR ARLTEIDKVV        60
     YNPNNVRKLD SIYDFQRLMI NTVVVPPVIV QANNISDVQN PRTLSVLGVR YEIKENARFS       120
     HTPPNWRDFL QFNVKSYEIG VDALPNELKP KNSAEERAFK EAMNKGIEDG VREADAIFKH       180
     QLNRLNQTYK GMIAFHRFVM DGKITMPAIA RRDIALTGNG NTLMLNQTNF EITSLPQFVN       240
     NTKLWNSRIL SIKERSVVKD PVETPVAIET QQ                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page