(data stored in ACNUC29543 zone)

EMBL: CP000521.PE657

CP000521.PE657       Location/Qualifiers
FT   CDS             741576..741908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3537"
FT                   /old_locus_tag="AS1_3537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3537"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89962"
FT                   /protein_id="ABS89962.2"
FT                   /translation="MKIPLIIIVVLCTLYFLNLSLKSNMKDIHKKEISDKAYFRLSSEY
FT                   GFVKASHAGDEMRSKIIKALSDGIIDGNEYVSITGEEPDYDLSTDAEKATYKEAKQKFI
FT                   DEFKPS"
     MKIPLIIIVV LCTLYFLNLS LKSNMKDIHK KEISDKAYFR LSSEYGFVKA SHAGDEMRSK        60
     IIKALSDGII DGNEYVSITG EEPDYDLSTD AEKATYKEAK QKFIDEFKPS                  110
//

If you have problems or comments...

PBIL Back to PBIL home page