(data stored in ACNUC29543 zone)

EMBL: CP000521.PE660

CP000521.PE660       Location/Qualifiers
FT   CDS             744711..745841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11094"
FT                   /protein_id="ABO11094.2"
FT                   /translation="MQLKFKNLALSMALVVAGSSYAEPSQQQSGQQQQATAQQTVPSSQ
FT                   PQGNNQSQGNNQQQGQQQANNQQAQAEAPSYIGTPPPNTINLGNVQTFGNSFPPPVRVA
FT                   KTKDEIVAEILSMELTPQQVKNIKDLLLRQERDASTPYTTTARPIVRSVPIDLSPAAQP
FT                   PVLRLSMGMLTSIVFSDLSGNPWEIEKVTFNKELFADDRPEQGQGQGEKSDISSKNTNI
FT                   FSIEPLTATAYGNVTVRLKGLSTPVIFILATGQNEVDMRIDARLAGRSPTSVNSSLRAN
FT                   MNATGVMSSIDSQTLLFLDGTPPVEAERIRTSDTSVEAWNFNGQYIVRSNDTVLYPSYK
FT                   STARSTGGTSIYVYPDPINQVTISRNGQPTTVYFNN"
     MQLKFKNLAL SMALVVAGSS YAEPSQQQSG QQQQATAQQT VPSSQPQGNN QSQGNNQQQG        60
     QQQANNQQAQ AEAPSYIGTP PPNTINLGNV QTFGNSFPPP VRVAKTKDEI VAEILSMELT       120
     PQQVKNIKDL LLRQERDAST PYTTTARPIV RSVPIDLSPA AQPPVLRLSM GMLTSIVFSD       180
     LSGNPWEIEK VTFNKELFAD DRPEQGQGQG EKSDISSKNT NIFSIEPLTA TAYGNVTVRL       240
     KGLSTPVIFI LATGQNEVDM RIDARLAGRS PTSVNSSLRA NMNATGVMSS IDSQTLLFLD       300
     GTPPVEAERI RTSDTSVEAW NFNGQYIVRS NDTVLYPSYK STARSTGGTS IYVYPDPINQ       360
     VTISRNGQPT TVYFNN                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page