(data stored in ACNUC29543 zone)

EMBL: CP000521.PE664

CP000521.PE664       Location/Qualifiers
FT   CDS             749083..749502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3543"
FT                   /old_locus_tag="AS1_3543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3543"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89968"
FT                   /protein_id="ABS89968.2"
FT                   /translation="MSKINNLQKVKNVGQDIYAQLGVAFTMGSLGITNAIAAPDTTNLT
FT                   GGNRQGQATGGDSVGDIRDRGINAMDAFMSFLQYAGMLVGFIVFVMGVIDFLNIGKPGK
FT                   DATAGKAGLKLLIGAVLAGAGYFYWSAANSASGNV"
     MSKINNLQKV KNVGQDIYAQ LGVAFTMGSL GITNAIAAPD TTNLTGGNRQ GQATGGDSVG        60
     DIRDRGINAM DAFMSFLQYA GMLVGFIVFV MGVIDFLNIG KPGKDATAGK AGLKLLIGAV       120
     LAGAGYFYWS AANSASGNV                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page