(data stored in ACNUC29543 zone)

EMBL: CP000521.PE668

CP000521.PE668       Location/Qualifiers
FT   CDS             754709..755119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3546"
FT                   /old_locus_tag="AS1_3546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3546"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89971"
FT                   /protein_id="ABS89971.2"
FT                   /translation="MNFHGNSLSQIQDKIQILIFESDKEESFLGETIHFYQFWIELLFF
FT                   LNQKKEVEIDMSKIQSSEDLQDLAELAYGHLYTSFMEKYGNDYYQTVKPLREYLDSLPA
FT                   FNPEDPNSYESTATKEQHAKIICKFSNTGLKQ"
     MNFHGNSLSQ IQDKIQILIF ESDKEESFLG ETIHFYQFWI ELLFFLNQKK EVEIDMSKIQ        60
     SSEDLQDLAE LAYGHLYTSF MEKYGNDYYQ TVKPLREYLD SLPAFNPEDP NSYESTATKE       120
     QHAKIICKFS NTGLKQ                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page