(data stored in ACNUC29543 zone)

EMBL: CP000521.PE669

CP000521.PE669       Location/Qualifiers
FT   CDS             755129..756706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0647"
FT                   /product="IcmO protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11096"
FT                   /protein_id="ABO11096.2"
FT                   /translation="MATPRFKGASDRFKPKDQRVDTRDIITKIHVALQTSEGSMYFAIT
FT                   ITIVVFVSFFFPLLLIIATPIAILITRKYLIPQLRYINMPYRVPKHANMPDGSFDGVAR
FT                   KVNLRKNPEKAYGQGVYYYGIDRQNHQQIWKSDSDERVHDLLIGTTGAGKTETIKMVLT
FT                   NPLLQNSGFILSDAKGTTELVAELMYLLTRFMRQDDYLVTNFITAGRDLLVRQEDKMTN
FT                   TFNLMSYTSAAMLSEQLVYLLADSEGSGGDMWKDRTITYLTATTHLLTFLRDRGLLLLE
FT                   PKTYVEYQELNQLIRAAYGEDFDDNYKNFGEIYITAVSPLRAYLKSLAGFDEGKLYKQP
FT                   EKCVEQHGYVIMQFTRAISDLSFNFGHIYGTKSGEIDMFDVVLNRRCLINVLPALQNAP
FT                   PTIRMLGKLFVGSIKQMMAGALGNRIDGMVRNVIEAKITASATCFKIVLDELAYQIVKG
FT                   LSVIPAQARGLTFSLTFSAQELKDIFVADEAEGEAIVANTGTKTFGRINSGTEGLSMQA
FT                   LRNVWWTK"
     MATPRFKGAS DRFKPKDQRV DTRDIITKIH VALQTSEGSM YFAITITIVV FVSFFFPLLL        60
     IIATPIAILI TRKYLIPQLR YINMPYRVPK HANMPDGSFD GVARKVNLRK NPEKAYGQGV       120
     YYYGIDRQNH QQIWKSDSDE RVHDLLIGTT GAGKTETIKM VLTNPLLQNS GFILSDAKGT       180
     TELVAELMYL LTRFMRQDDY LVTNFITAGR DLLVRQEDKM TNTFNLMSYT SAAMLSEQLV       240
     YLLADSEGSG GDMWKDRTIT YLTATTHLLT FLRDRGLLLL EPKTYVEYQE LNQLIRAAYG       300
     EDFDDNYKNF GEIYITAVSP LRAYLKSLAG FDEGKLYKQP EKCVEQHGYV IMQFTRAISD       360
     LSFNFGHIYG TKSGEIDMFD VVLNRRCLIN VLPALQNAPP TIRMLGKLFV GSIKQMMAGA       420
     LGNRIDGMVR NVIEAKITAS ATCFKIVLDE LAYQIVKGLS VIPAQARGLT FSLTFSAQEL       480
     KDIFVADEAE GEAIVANTGT KTFGRINSGT EGLSMQALRN VWWTK                       525
//

If you have problems or comments...

PBIL Back to PBIL home page