(data stored in ACNUC29543 zone)

EMBL: CP000521.PE671

CP000521.PE671       Location/Qualifiers
FT   CDS             756694..757866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3548"
FT                   /old_locus_tag="AS1_3548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3548"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89973"
FT                   /protein_id="ABS89973.2"
FT                   /translation="MDQVTQSVVNGYNIASSAMGINYQSSTNVNIEKQDRISYQDIASQ
FT                   QEGQFTIVVAKKIDGGKEGGVFAIHAQTMFVQPPKLAKIRLNDFVSIEKELTYFDSKKY
FT                   DNELKNFAYQLAENKILQSCPNYKKHAIGALNQVDTHLESISKMAKLYETDVKSGFFAI
FT                   MRTMQNMLDSVQISGFSAPFYEVVDSTFANEIDGALDSIFTEIKLDTEEVDVVLNKTID
FT                   HIQDERSQDLLTKTSETIIDEIVDQYLNLDSSEIETIEAVNAYIEALPNVYDDQLYSEE
FT                   FATTVREHLKQHDIYIQSLDIPSFEDLLELDQCAAEAQKSIFSDDFEEDDLFSDAQERY
FT                   NYVTDFIKCKNLVFEEKEKEIESEDQEILSKLEKYHEIVYRMISAKLKDK"
     MDQVTQSVVN GYNIASSAMG INYQSSTNVN IEKQDRISYQ DIASQQEGQF TIVVAKKIDG        60
     GKEGGVFAIH AQTMFVQPPK LAKIRLNDFV SIEKELTYFD SKKYDNELKN FAYQLAENKI       120
     LQSCPNYKKH AIGALNQVDT HLESISKMAK LYETDVKSGF FAIMRTMQNM LDSVQISGFS       180
     APFYEVVDST FANEIDGALD SIFTEIKLDT EEVDVVLNKT IDHIQDERSQ DLLTKTSETI       240
     IDEIVDQYLN LDSSEIETIE AVNAYIEALP NVYDDQLYSE EFATTVREHL KQHDIYIQSL       300
     DIPSFEDLLE LDQCAAEAQK SIFSDDFEED DLFSDAQERY NYVTDFIKCK NLVFEEKEKE       360
     IESEDQEILS KLEKYHEIVY RMISAKLKDK                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page