(data stored in ACNUC29543 zone)

EMBL: CP000521.PE674

CP000521.PE674       Location/Qualifiers
FT   CDS             complement(760150..760611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11097"
FT                   /protein_id="ABO11097.1"
FT                   /translation="MKNIFVLSLALLGAPVAYADFQGKVIKVADGDTLTVLVNGNTQER
FT                   VRLENIDAPESSQAYGQQARNFLNSQVYGKFVYVKSNKMDLYKRHIGTIYLGNYNINQS
FT                   IVQNGYAWAFREYLTDPNYIKYEQYARQNRLGLWKDNNPIYPSNWRRSK"
     MKNIFVLSLA LLGAPVAYAD FQGKVIKVAD GDTLTVLVNG NTQERVRLEN IDAPESSQAY        60
     GQQARNFLNS QVYGKFVYVK SNKMDLYKRH IGTIYLGNYN INQSIVQNGY AWAFREYLTD       120
     PNYIKYEQYA RQNRLGLWKD NNPIYPSNWR RSK                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page