(data stored in ACNUC29543 zone)

EMBL: CP000521.PE677

CP000521.PE677       Location/Qualifiers
FT   CDS             765518..766249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3552"
FT                   /old_locus_tag="AS1_3552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3552"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89977"
FT                   /protein_id="ABS89977.2"
FT                   /translation="MLKKIGKAFVYLYVTLPLKGIAGNLGYKHLKNDYEFNKQQYKSLK
FT                   KIHCPACFKSIVQTSQIKLTDNEIVEHKAPAKAVKVTLKCANPECSFENSFISGPSKKE
FT                   ISEKTNNAILAVGRESAKRIFEVIPVGQVNNSIKEHYEMAIMLRNISIFCVIGCFAFTF
FT                   YQIFFKDNSLFFTALSAFSWLVIGLGIFLNALKYSHKSWQAQTLKVFEQQSQFYFWFKN
FT                   HAWFSKPKYWRISGEGKNATK"
     MLKKIGKAFV YLYVTLPLKG IAGNLGYKHL KNDYEFNKQQ YKSLKKIHCP ACFKSIVQTS        60
     QIKLTDNEIV EHKAPAKAVK VTLKCANPEC SFENSFISGP SKKEISEKTN NAILAVGRES       120
     AKRIFEVIPV GQVNNSIKEH YEMAIMLRNI SIFCVIGCFA FTFYQIFFKD NSLFFTALSA       180
     FSWLVIGLGI FLNALKYSHK SWQAQTLKVF EQQSQFYFWF KNHAWFSKPK YWRISGEGKN       240
     ATK                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page