(data stored in ACNUC29543 zone)

EMBL: CP000521.PE681

CP000521.PE681       Location/Qualifiers
FT   CDS             complement(769266..770369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3555"
FT                   /old_locus_tag="AS1_3555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3555"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89980"
FT                   /protein_id="ABS89980.2"
FT                   /translation="MNVKPLDYLATIEHIFEHVKRTFYQTVADTKSINKGRLNAPITEY
FT                   KWHPCVFLPTNLWQEVLRPTIMAKLYEQVQINKTKDPFVIDAYFANFVAAFTWRYTKSI
FT                   YRFDEYTFECLIKHSAGKYLDHQLLTNLPEGCIYIDLATPLNIADHKVYGVYAILDLSS
FT                   NSIDTLKNTLPDQLIITLDTHNPFEENNFALLKPLPTIVFDIKRSGKVSQQIKFKWGIN
FT                   LESPEELNEHIAPVISLISSICTDEIAIDNFTKNSTRQNVTKKPSFKDLEAAYWQKGEY
FT                   RVNAPANHKMWRIGVKYGVDYRAFVARQQKYESKTEYRITGVHWTAYIQDYEIRLKFMP
FT                   PRMNSPVEIDEQINNFFDELNASNSLK"
     MNVKPLDYLA TIEHIFEHVK RTFYQTVADT KSINKGRLNA PITEYKWHPC VFLPTNLWQE        60
     VLRPTIMAKL YEQVQINKTK DPFVIDAYFA NFVAAFTWRY TKSIYRFDEY TFECLIKHSA       120
     GKYLDHQLLT NLPEGCIYID LATPLNIADH KVYGVYAILD LSSNSIDTLK NTLPDQLIIT       180
     LDTHNPFEEN NFALLKPLPT IVFDIKRSGK VSQQIKFKWG INLESPEELN EHIAPVISLI       240
     SSICTDEIAI DNFTKNSTRQ NVTKKPSFKD LEAAYWQKGE YRVNAPANHK MWRIGVKYGV       300
     DYRAFVARQQ KYESKTEYRI TGVHWTAYIQ DYEIRLKFMP PRMNSPVEID EQINNFFDEL       360
     NASNSLK                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page