(data stored in ACNUC29543 zone)

EMBL: CP000521.PE682

CP000521.PE682       Location/Qualifiers
FT   CDS             770543..772804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0651"
FT                   /product="TraB protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11100"
FT                   /protein_id="ABO11100.2"
FT                   /translation="MTDLVIVESSNKVDSIQGYLDSLFGRGKFKVSFSKGHIRDLPKDS
FT                   LGLTAEYTPNYVFNDSGASRVRELKALVEKSQKVYLATDPDREGEAIAWHLKTVLRLNE
FT                   NYGRVTFQEITKTAVAQAMGNERKLNMQVVQAQETRRILDRIIGYIGTPAFTLICGEKQ
FT                   IAGRVQSSIVWYLVDLENKIKQFSSVLHFGVTFNFGSVDESWEAKWDTSNFITKLDPFV
FT                   IDRKLAEEVSKLREFTVETFEEKPEKSSPPAPFTTPTYLRAAHVQLKLKTKRAMEIAQK
FT                   LFEDGHITYIRTDSPNLSDDAIQAIREFALKNKLPIPATPRKFKSKALAQEGHEAIRPT
FT                   DFNQLKVSDDSTIQAVYQMIWLRSVACQLDDATFTARIVRMKGRQLVQGREVFVKARGR
FT                   KLIDQGWLRLTAKLNFSEDENEDIPEDAAQELNNPVPLLQKAGNLVALKSDLNEKRTEP
FT                   PRRHSEASLIKFMEDVGIGRPSTFVSIVSKIIDHGYVHLDSKNKIHATDLAQRLVGKIS
FT                   NQFEFCNLKYTAELEGKLDLIAHGENIGKRLLKETHLKIETQAKESIKNLDQGGPKQYC
FT                   SKCSEQLVNMTSANGKPYFKCTNLKCGHMMMNQDGIAIDRESLTSEFKCIVCESGLISR
FT                   SGQNGEFFGCSGFFKKRNKCTASYQKKPDGTPDYQAFLAKRELKESKQEQGEKPVPKNT
FT                   EKKEKEFNCPECKALLQQRTGKSKTTNKKWEIWSCSSPNCKNEYWGERNKPIFDKKIVK
FT                   "
     MTDLVIVESS NKVDSIQGYL DSLFGRGKFK VSFSKGHIRD LPKDSLGLTA EYTPNYVFND        60
     SGASRVRELK ALVEKSQKVY LATDPDREGE AIAWHLKTVL RLNENYGRVT FQEITKTAVA       120
     QAMGNERKLN MQVVQAQETR RILDRIIGYI GTPAFTLICG EKQIAGRVQS SIVWYLVDLE       180
     NKIKQFSSVL HFGVTFNFGS VDESWEAKWD TSNFITKLDP FVIDRKLAEE VSKLREFTVE       240
     TFEEKPEKSS PPAPFTTPTY LRAAHVQLKL KTKRAMEIAQ KLFEDGHITY IRTDSPNLSD       300
     DAIQAIREFA LKNKLPIPAT PRKFKSKALA QEGHEAIRPT DFNQLKVSDD STIQAVYQMI       360
     WLRSVACQLD DATFTARIVR MKGRQLVQGR EVFVKARGRK LIDQGWLRLT AKLNFSEDEN       420
     EDIPEDAAQE LNNPVPLLQK AGNLVALKSD LNEKRTEPPR RHSEASLIKF MEDVGIGRPS       480
     TFVSIVSKII DHGYVHLDSK NKIHATDLAQ RLVGKISNQF EFCNLKYTAE LEGKLDLIAH       540
     GENIGKRLLK ETHLKIETQA KESIKNLDQG GPKQYCSKCS EQLVNMTSAN GKPYFKCTNL       600
     KCGHMMMNQD GIAIDRESLT SEFKCIVCES GLISRSGQNG EFFGCSGFFK KRNKCTASYQ       660
     KKPDGTPDYQ AFLAKRELKE SKQEQGEKPV PKNTEKKEKE FNCPECKALL QQRTGKSKTT       720
     NKKWEIWSCS SPNCKNEYWG ERNKPIFDKK IVK                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page