(data stored in ACNUC29543 zone)

EMBL: CP000521.PE683

CP000521.PE683       Location/Qualifiers
FT   CDS             773871..775658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3557"
FT                   /old_locus_tag="AS1_3557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3557"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89982"
FT                   /protein_id="ABS89982.2"
FT                   /translation="MPVNNDKITTIDCFPNDNISRVVYRYGGLVRNEDNDSTNPFVEVL
FT                   LIEIRKSDQWLFLDKCSTFLVPVLDLDAVQHGSIWDGNVLTNYTYRFSGKLITKRFSFD
FT                   FSNNKPRNIKLSDKIPDTSEYYIPLKNYFLPNKVDYVLQGYPFTKYTNDSYRKVNHCLM
FT                   HSNDGTQVITSSIHILHSLFVNRKDIRGLLLSTSGQSIINRFLESYTTEVENDNIEYKI
FT                   KIRKPYEDIGETAIIFLANLALNPYVQTIVDKIQRSMEVTEFHHLQHGTGIRYPIVYPP
FT                   HPTKLFLEAEGIWLDDNKTRFFITRVKKFDPINDHMIDVNKDLTNTVSKTDEKNPRPRE
FT                   KSQNKNEHINTQKPPSRTSGEYRKRSDVETGNTQNILKYSFNEPANDPIEVGTSNHPYS
FT                   DKSEDVETSSDEPYGNKNTKTKKSETTDNPPSRDERFDIQYIIQSLNHLTLDTTSPLER
FT                   VYSIDILGNEIHGFNLLQIKKLVPQPKHPSWIDAEFGRKLLFLKLELKDQHDQYYLIDI
FT                   HKNKSHEAFCAFIIVSPHKLTREQIKNICIELENAKGIKKWTLRCESFTKKIISIKHSS
FT                   ATPDEWKNRFKNLFSTLIN"
     MPVNNDKITT IDCFPNDNIS RVVYRYGGLV RNEDNDSTNP FVEVLLIEIR KSDQWLFLDK        60
     CSTFLVPVLD LDAVQHGSIW DGNVLTNYTY RFSGKLITKR FSFDFSNNKP RNIKLSDKIP       120
     DTSEYYIPLK NYFLPNKVDY VLQGYPFTKY TNDSYRKVNH CLMHSNDGTQ VITSSIHILH       180
     SLFVNRKDIR GLLLSTSGQS IINRFLESYT TEVENDNIEY KIKIRKPYED IGETAIIFLA       240
     NLALNPYVQT IVDKIQRSME VTEFHHLQHG TGIRYPIVYP PHPTKLFLEA EGIWLDDNKT       300
     RFFITRVKKF DPINDHMIDV NKDLTNTVSK TDEKNPRPRE KSQNKNEHIN TQKPPSRTSG       360
     EYRKRSDVET GNTQNILKYS FNEPANDPIE VGTSNHPYSD KSEDVETSSD EPYGNKNTKT       420
     KKSETTDNPP SRDERFDIQY IIQSLNHLTL DTTSPLERVY SIDILGNEIH GFNLLQIKKL       480
     VPQPKHPSWI DAEFGRKLLF LKLELKDQHD QYYLIDIHKN KSHEAFCAFI IVSPHKLTRE       540
     QIKNICIELE NAKGIKKWTL RCESFTKKII SIKHSSATPD EWKNRFKNLF STLIN            595
//

If you have problems or comments...

PBIL Back to PBIL home page