(data stored in ACNUC29543 zone)

EMBL: CP000521.PE687

CP000521.PE687       Location/Qualifiers
FT   CDS             778319..778627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0654"
FT                   /product="regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11103"
FT                   /protein_id="ABO11103.2"
FT                   /translation="MRLLVVAGAEGMASGQIAEALDGAAPSRISFHLSHLENAGLIYSR
FT                   REGRQIIYCAIWSTLADLVAFLMHDCCQGHCEYCDKAIELFAKCTGEPTEGYIKIGE"
     MRLLVVAGAE GMASGQIAEA LDGAAPSRIS FHLSHLENAG LIYSRREGRQ IIYCAIWSTL        60
     ADLVAFLMHD CCQGHCEYCD KAIELFAKCT GEPTEGYIKI GE                          102
//

If you have problems or comments...

PBIL Back to PBIL home page