(data stored in ACNUC29543 zone)

EMBL: CP000521.PE688

CP000521.PE688       Location/Qualifiers
FT   CDS             778665..779627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0655"
FT                   /product="putative efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11104"
FT                   /protein_id="ABO11104.2"
FT                   /translation="MENLRSLLEDHQVKIYFITIFIGTIFGLTISGVSSLESAINPALA
FT                   LMLFATFLQVPIAEIGKAFKNLKFISALLITNFIALPAITAGLIQFLPENPLIRLAVLF
FT                   VLLAPCIDYVITFTHVGKGNARLLLAMTPILLLIQMILLPVYLGTLLGDEVSQLVEMEP
FT                   FLHAFIWFIIVPLTLAGIVQFISNKSESLATLSAPLNLLPVPATALVLFIVLASVTPQI
FT                   GLAQSAALQALPIYIAFAIIAPFIGWAIASLFKLESSSARAVSFSASYRNSLVILPLAL
FT                   VVPGSMPIIPAVILTQTIVELCFLPIYTRLIPRMFPSKD"
     MENLRSLLED HQVKIYFITI FIGTIFGLTI SGVSSLESAI NPALALMLFA TFLQVPIAEI        60
     GKAFKNLKFI SALLITNFIA LPAITAGLIQ FLPENPLIRL AVLFVLLAPC IDYVITFTHV       120
     GKGNARLLLA MTPILLLIQM ILLPVYLGTL LGDEVSQLVE MEPFLHAFIW FIIVPLTLAG       180
     IVQFISNKSE SLATLSAPLN LLPVPATALV LFIVLASVTP QIGLAQSAAL QALPIYIAFA       240
     IIAPFIGWAI ASLFKLESSS ARAVSFSASY RNSLVILPLA LVVPGSMPII PAVILTQTIV       300
     ELCFLPIYTR LIPRMFPSKD                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page